RAB9B (NM_016370) Human Recombinant Protein
CAT#: TP310826
Recombinant protein of human RAB9B, member RAS oncogene family (RAB9B), 20 µg
View other "RAB9B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210826 protein sequence
Red=Cloning site Green=Tags(s) MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057454 |
Locus ID | 51209 |
UniProt ID | Q9NP90 |
Refseq Size | 3799 |
Cytogenetics | Xq22.2 |
Refseq ORF | 603 |
Synonyms | Rab-9L; RAB9L |
Summary | This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413988 | RAB9B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413988 | Transient overexpression lysate of RAB9B, member RAS oncogene family (RAB9B) |
CNY 3,080.00 |
|
PH310826 | RAB9B MS Standard C13 and N15-labeled recombinant protein (NP_057454) |
CNY 19,520.00 |