IFNA5 (NM_002169) Human Recombinant Protein
CAT#: TP310825
Recombinant protein of human interferon, alpha 5 (IFNA5), 20 µg
View other "IFNA5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210825 protein sequence
Red=Cloning site Green=Tags(s) MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQ FQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSI LTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002160 |
Locus ID | 3442 |
UniProt ID | P01569 |
Refseq Size | 700 |
Cytogenetics | 9p21.3 |
Refseq ORF | 567 |
Synonyms | IFN-alpha-5; IFN-alphaG; INA5; INFA5; leIF G |
Summary | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419486 | IFNA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419486 | Transient overexpression lysate of interferon, alpha 5 (IFNA5) |
CNY 3,080.00 |
|
PH310825 | IFNA5 MS Standard C13 and N15-labeled recombinant protein (NP_002160) |
CNY 19,520.00 |