RAB5C (NM_201434) Human Recombinant Protein

CAT#: TP310698

Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "RAB5C" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Cited in 1 publication.

Product images

经常一起买 (2)
Anti-RAB5C Rabbit Polyclonal Antibody
    • 100 ul

CNY 3,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s)

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
SQCCSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Bioactivity Enzyme activity (PMID: 26030178)
Reference Data
RefSeq NP_958842
Locus ID 5878
UniProt ID P51148, A0A024R1U4
Refseq Size 1791
Cytogenetics 17q21.2
Refseq ORF 648
Synonyms L1880; RAB5CL; RAB5L; RABL
Summary Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010]
Protein Families Druggable Genome
Protein Pathways Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Documents

Other Versions

Customer Reviews 
Loading...