United States
Germany
Japan
United Kingdom
China
DDX4 (NM_024415) Human Recombinant Protein
CAT＃: TP310628
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1, 20 µg
View other "DDX4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210628 protein sequence
Red=Cloning site Green=Tags(s) MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDA GECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSE ASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGG YKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSG HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHM MHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQR LAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFL CQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGR TGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKG KSTLNTAGFSSSQAPNPVDDESWD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 79.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_077726 |
| Locus ID | 54514 |
| UniProt ID | Q9NQI0 |
| Refseq Size | 2880 |
| Cytogenetics | 5q11.2 |
| Refseq ORF | 2172 |
| Synonyms | VASA |
| Summary | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411272 | DDX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427781 | DDX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC433297 | DDX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411272 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1 |
CNY 3,080.00 |
|
| LY427781 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3 |
CNY 4,840.00 |
|
| LY433297 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 4 |
CNY 3,080.00 |
|
| PH310628 | DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_077726) |
CNY 19,520.00 |
|
| PH326957 | DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_001129506) |
CNY 19,520.00 |
|
| TP326957 | Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3, 20 µg |
CNY 2,900.00 |
