SLAMF9 (NM_033438) Human Recombinant Protein
CAT#: TP310366
Recombinant protein of human SLAM family member 9 (SLAMF9), 20 µg
View other "SLAMF9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210366 protein sequence
Red=Cloning site Green=Tags(s) MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEG HPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITV NFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVS SCPIPDGPFYADPNYASEKPSTAFCLLAKGLLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRK EAKPGSSPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_254273 |
Locus ID | 89886 |
UniProt ID | Q96A28 |
Refseq Size | 1170 |
Cytogenetics | 1q23.2 |
Refseq ORF | 867 |
Synonyms | CD2F-10; CD2F10; CD84-H1; CD84H1; SF2001 |
Summary | This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409497 | SLAMF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409497 | Transient overexpression lysate of SLAM family member 9 (SLAMF9), transcript variant 1 |
CNY 3,080.00 |
|
PH310366 | SLAMF9 MS Standard C13 and N15-labeled recombinant protein (NP_254273) |
CNY 19,520.00 |