Galactoside 2 alpha L fucosyltransferase 1 (FUT1) (NM_000148) Human Recombinant Protein
CAT#: TP310361
Recombinant protein of human fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) (FUT1), 20 µg
View other "Galactoside 2 alpha L fucosyltransferase 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210361 protein sequence
Red=Cloning site Green=Tags(s) MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSC PQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTP WRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDR PRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVT FAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWV GINADLSPLWTLAKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000139 |
Locus ID | 2523 |
UniProt ID | P19526 |
Refseq Size | 4246 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1095 |
Synonyms | H; HH; HSC |
Summary | This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424898 | FUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424898 | Transient overexpression lysate of fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group) (FUT1) |
CNY 3,080.00 |
|
PH310361 | FUT1 MS Standard C13 and N15-labeled recombinant protein (NP_000139) |
CNY 19,520.00 |
其它Galactoside 2 alpha L fucosyltransferase 1产品