PIGH (NM_004569) Human Recombinant Protein
CAT#: TP310028
Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class H (PIGH), 20 µg
View other "PIGH" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210028 protein sequence
Red=Cloning site Green=Tags(s) MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCENSMILSAAIF ITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCIL LKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004560 |
Locus ID | 5283 |
UniProt ID | Q14442 |
Refseq Size | 1439 |
Cytogenetics | 14q24.1 |
Refseq ORF | 564 |
Synonyms | GPI-H |
Summary | This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The protein encoded by this gene is a subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417898 | PIGH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417898 | Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class H (PIGH) |
CNY 3,080.00 |
|
PH310028 | PIGH MS Standard C13 and N15-labeled recombinant protein (NP_004560) |
CNY 19,520.00 |