CIAPIN1 (NM_020313) Human Recombinant Protein
CAT#: TP309626
Recombinant protein of human cytokine induced apoptosis inhibitor 1 (CIAPIN1), 20 µg
View other "CIAPIN1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209626 protein sequence
Red=Cloning site Green=Tags(s) MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064709 |
Locus ID | 57019 |
UniProt ID | Q6FI81 |
Refseq Size | 2106 |
Cytogenetics | 16q21 |
Refseq ORF | 936 |
Synonyms | Anamorsin; CIAE2; DRE2; PRO0915 |
Summary | CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412554 | CIAPIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412554 | Transient overexpression lysate of cytokine induced apoptosis inhibitor 1 (CIAPIN1) |
CNY 3,080.00 |
|
PH309626 | CIAPIN1 MS Standard C13 and N15-labeled recombinant protein (NP_064709) |
CNY 19,520.00 |
其它CIAPIN1产品