VGF (NM_003378) Human Recombinant Protein
CAT#: TP309477
Recombinant protein of human VGF nerve growth factor inducible (VGF), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209477 representing NM_003378
Red=Cloning site Green=Tags(s) MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDE GELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRP QTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASW GEFQARVPERAPLPPPAPSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKAR RPESALLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRG LQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEP VPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSA LRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHVLLRRP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 65 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003369 |
Locus ID | 7425 |
UniProt ID | O15240 |
Refseq Size | 2545 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1845 |
Synonyms | SCG7; SgVII |
Summary | This gene is specifically expressed in a subpopulation of neuroendocrine cells, and is upregulated by nerve growth factor. The structural organization of this gene is similar to that of the rat gene, and both the translated and the untranslated regions show a high degree of sequence similarity to the rat gene. The encoded secretory protein also shares similarities with the secretogranin/chromogranin family, however, its exact function is not known. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Cerebrospinal Fluid and Brain Proteoforms of the Granin Neuropeptide Family in Alzheimer’s Disease
,null,
Journal of the American Society for Mass Spectrometry
,PubMed ID 36912488
[VGF]
|
Longitudinal CSF proteomics identifies NPTX2 as a prognostic biomarker of Alzheimer\'s disease
,Libiger, O;Shaw, LM;Watson, MH;Nairn, AC;Umaña, KL;Biarnes, MC;Canet-Avilés, RM;Jack, CR;Breton, YA;Cortes, L;Chelsky, D;Spellman, DS;Baker, SA;Raghavan, N;Potter, WZ;Alzheimer's Disease Neuroimaging Initiative (ADNI), ;Foundation for the National Institutes of Health (FNIH) Biomarkers Consortium, Longitudinal CSF Proteomics Project Team, ;,
Alzheimer's & dementia : the journal of the Alzheimer's Association
,PubMed ID 33984181
[VGF]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418733 | VGF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418733 | Transient overexpression lysate of VGF nerve growth factor inducible (VGF) |
CNY 3,080.00 |
|
PH309477 | VGF MS Standard C13 and N15-labeled recombinant protein (NP_003369) |
CNY 19,520.00 |