PRMT3 (NM_005788) Human Recombinant Protein
CAT#: TP309382
Recombinant protein of human protein arginine methyltransferase 3 (PRMT3), transcript variant 1, 20 µg
View other "PRMT3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209382 protein sequence
Red=Cloning site Green=Tags(s) MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP FSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005779 |
Locus ID | 10196 |
UniProt ID | O60678 |
Refseq Size | 2743 |
Cytogenetics | 11p15.1 |
Refseq ORF | 1593 |
Synonyms | HRMT1L3 |
Summary | This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417075 | PRMT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428738 | PRMT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417075 | Transient overexpression lysate of protein arginine methyltransferase 3 (PRMT3), transcript variant 1 |
CNY 3,080.00 |
|
LY428738 | Transient overexpression lysate of protein arginine methyltransferase 3 (PRMT3), transcript variant 2 |
CNY 3,080.00 |
|
PH309382 | PRMT3 MS Standard C13 and N15-labeled recombinant protein (NP_005779) |
CNY 19,520.00 |