PIGL (NM_004278) Human Recombinant Protein
CAT#: TP309339
Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL), 20 µg
View other "PIGL" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209339 protein sequence
Red=Cloning site Green=Tags(s) MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004269 |
Locus ID | 9487 |
UniProt ID | Q9Y2B2 |
Refseq Size | 1163 |
Cytogenetics | 17p11.2 |
Refseq ORF | 756 |
Synonyms | CHIME |
Summary | This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418094 | PIGL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418094 | Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class L (PIGL) |
CNY 3,080.00 |
|
PH309339 | PIGL MS Standard C13 and N15-labeled recombinant protein (NP_004269) |
CNY 19,520.00 |