MTRFR (NM_152269) Human Recombinant Protein
CAT#: TP309162
Recombinant protein of human chromosome 12 open reading frame 65 (C12orf65), transcript variant 1, 20 µg
View other "MTRFR" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209162 protein sequence
Red=Cloning site Green=Tags(s) MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGP GGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAAKKKQE RKKRAKETLEKKKLLKELWESSKKVH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689482 |
Locus ID | 91574 |
UniProt ID | Q9H3J6 |
Refseq Size | 1692 |
Cytogenetics | 12q24.31 |
Refseq ORF | 498 |
Synonyms | C12orf65; COXPD7; SPG55 |
Summary | This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termination in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407691 | C12orf65 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428398 | C12orf65 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407691 | Transient overexpression lysate of chromosome 12 open reading frame 65 (C12orf65), transcript variant 1 |
CNY 3,080.00 |
|
LY428398 | Transient overexpression lysate of chromosome 12 open reading frame 65 (C12orf65), transcript variant 2 |
CNY 3,080.00 |
|
PH309162 | C12orf65 MS Standard C13 and N15-labeled recombinant protein (NP_689482) |
CNY 19,520.00 |