SOX4 (NM_003107) Human Recombinant Protein
CAT#: TP309139
Recombinant protein of human SRY (sex determining region Y)-box 4 (SOX4), 20 µg
View other "SOX4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209139 protein sequence
Red=Cloning site Green=Tags(s) MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWS QIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNAN SSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCGSKVAGGAGGG VSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAA LAAPGKHLAEKKVKRVYLFGGLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPA AGRSPADHRGYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 25761772) |
Reference Data | |
RefSeq | NP_003098 |
Locus ID | 6659 |
UniProt ID | Q06945 |
Refseq Size | 4912 |
Cytogenetics | 6p22.3 |
Refseq ORF | 1422 |
Synonyms | CSS10; EVI16 |
Summary | This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
SOXC Transcription Factors Induce Cartilage Growth Plate Formation in Mouse Embryos by Promoting Noncanonical WNT Signaling
,Kato, K;Bhattaram, P;Penzo-Méndez, A;Gadi, A;Lefebvre, V;,
J. Bone Miner. Res.
,PubMed ID 25761772
[SOX4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418894 | SOX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418894 | Transient overexpression lysate of SRY (sex determining region Y)-box 4 (SOX4) |
CNY 3,080.00 |
|
PH309139 | SOX4 MS Standard C13 and N15-labeled recombinant protein (NP_003098) |
CNY 19,520.00 |