Angiogenin (ANG) (NM_001145) Human Recombinant Protein
CAT#: TP308874
Recombinant protein of human angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 1, 20 µg
View other "Angiogenin" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208874 protein sequence
Red=Cloning site Green=Tags(s) MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD QSIFRRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001136 |
Locus ID | 283 |
UniProt ID | P03950 |
Refseq Size | 1222 |
Cytogenetics | 14q11.2 |
Refseq ORF | 441 |
Synonyms | ALS9; HEL168; RAA1; RNASE4; RNASE5 |
Summary | The protein encoded by this gene is a member of the RNase A superfamily though it has relatively weak ribonucleolytic activity. This protein is a potent mediator of new blood vessel formation and thus, in addition to the name RNase5, is commonly called angiogenin. This protein induces angiogenesis after binding to actin on the surface of endothelial cells. This protein also accumulates at the nucleolus where it stimulates ribosomal transcription. Under stress conditions this protein translocates to the cytosol where it hydrolyzes cellular tRNAs and influences protein synthesis. A signal peptide is cleaved from the precursor protein to produce a mature protein which contains a nuclear localization signal, a cell binding motif, and a catalytic domain. This protein has been shown to be both neurotrophic and neuroprotective and the mature protein has antimicrobial activity against some bacteria and fungi, including S. pneumoniae and C. albicans. Due to its effect on rRNA production and angiogenesis this gene plays important roles in cell growth and tumor progression. Mutations in this gene are associated with progression of amyotrophic lateral sclerosis (ALS). This gene and the neighboring RNase4 gene share promoters and 5' exons though each gene then splices to a distinct 3' exon containing the complete coding region of each gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420108 | ANG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420124 | ANG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420108 | Transient overexpression lysate of angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 1 |
CNY 3,080.00 |
|
LY420124 | Transient overexpression lysate of angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 2 |
CNY 3,080.00 |
|
PH308874 | ANG MS Standard C13 and N15-labeled recombinant protein (NP_001136) |
CNY 19,520.00 |
|
TP720180 | Recombinant protein of human angiogenin, ribonuclease, RNase A family, 5 (ANG), transcript variant 2 |
CNY 3,140.00 |
其它Angiogenin产品