DCUN1D2 (NM_001014283) Human Recombinant Protein
CAT#: TP308865
Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2), 20 µg
View other "DCUN1D2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208865 protein sequence
Red=Cloning site Green=Tags(s) MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014305 |
Locus ID | 55208 |
UniProt ID | Q6PH85 |
Refseq Size | 3046 |
Cytogenetics | 13q34 |
Refseq ORF | 777 |
Synonyms | C13orf17 |
Summary | Potently stimulates the neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes from the NEDD8-conjugating E2 enzyme UBC12. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423049 | DCUN1D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423049 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2) |
CNY 3,080.00 |
|
PH308865 | DCUN1D2 MS Standard C13 and N15-labeled recombinant protein (NP_001014305) |
CNY 19,520.00 |
其它DCUN1D2产品