EIF4EBP2 (NM_004096) Human Recombinant Protein
CAT#: TP308664
Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2), 20 µg
View other "EIF4EBP2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208664 protein sequence
Red=Cloning site Green=Tags(s) MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004087 |
Locus ID | 1979 |
UniProt ID | Q13542, A0A024QZM3 |
Refseq Size | 7531 |
Cytogenetics | 10q22.1 |
Refseq ORF | 360 |
Synonyms | 4EBP2; PHASII |
Summary | This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418216 | EIF4EBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418216 | Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) |
CNY 3,080.00 |
|
PH308664 | EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087) |
CNY 19,520.00 |
|
TP720559 | Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 2 (EIF4EBP2) |
CNY 5,460.00 |
其它EIF4EBP2产品