POLR1H (NM_170783) Human Recombinant Protein
CAT#: TP308651
Recombinant protein of human zinc ribbon domain containing 1 (ZNRD1), transcript variant a, 20 µg
View other "POLR1H" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208651 protein sequence
Red=Cloning site Green=Tags(s) MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_740753 |
Locus ID | 30834 |
UniProt ID | Q9P1U0 |
Refseq Size | 885 |
Cytogenetics | 6p22.1 |
Refseq ORF | 378 |
Synonyms | A12.2; HTEX-6; HTEX6; hZR14; Rpa12; tctex-6; TCTEX6; TEX6; ZNRD1; ZR14 |
Summary | This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Transcription Factors |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406880 | ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415176 | ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406880 | Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant a |
CNY 3,080.00 |
|
LY415176 | Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant b |
CNY 3,080.00 |
|
PH308651 | ZNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_740753) |
CNY 19,520.00 |