LRATD1 (NM_145175) Human Recombinant Protein
CAT#: TP308623
Recombinant protein of human family with sequence similarity 84, member A (FAM84A), 20 µg
View other "LRATD1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208623 protein sequence
Red=Cloning site Green=Tags(s) MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV LQELADLVDDKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Immunoprecipitation (PMID: 27325759) |
Reference Data | |
RefSeq | NP_660158 |
Locus ID | 151354 |
UniProt ID | Q96KN4 |
Refseq Size | 6366 |
Cytogenetics | 2p24.3 |
Refseq ORF | 876 |
Synonyms | FAM84A; NSE1; PP11517 |
Summary | May play a role in cell morphology and motility.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Distinct oligoclonal band antibodies in multiple sclerosis recognize ubiquitous self-proteins
,Brändle, SM;Obermeier, B;Senel, M;Bruder, J;Mentele, R;Khademi, M;Olsson, T;Tumani, H;Kristoferitsch, W;Lottspeich, F;Wekerle, H;Hohlfeld, R;Dornmair, K;,
Proc. Natl. Acad. Sci. U.S.A.
,PubMed ID 27325759
[LRATD1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408037 | FAM84A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408037 | Transient overexpression lysate of family with sequence similarity 84, member A (FAM84A) |
CNY 3,080.00 |
|
PH308623 | FAM84A MS Standard C13 and N15-labeled recombinant protein (NP_660158) |
CNY 19,520.00 |
|
TP710355 | Purified recombinant protein of human family with sequence similarity 84, member A (FAM84A), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |