OLIG3 (NM_175747) Human Recombinant Protein
CAT#: TP308613
Recombinant protein of human oligodendrocyte transcription factor 3 (OLIG3), 20 µg
View other "OLIG3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208613 protein sequence
Red=Cloning site Green=Tags(s) MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSS LEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIR PPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_786923 |
Locus ID | 167826 |
UniProt ID | Q7RTU3 |
Refseq Size | 2196 |
Cytogenetics | 6q23.3 |
Refseq ORF | 816 |
Synonyms | Bhlhb7; bHLHe20 |
Summary | May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406237 | OLIG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406237 | Transient overexpression lysate of oligodendrocyte transcription factor 3 (OLIG3) |
CNY 3,080.00 |
|
PH308613 | OLIG3 MS Standard C13 and N15-labeled recombinant protein (NP_786923) |
CNY 19,520.00 |