CABS1 (NM_033122) Human Recombinant Protein
CAT#: TP308496
Recombinant protein of human chromosome 4 open reading frame 35 (C4orf35), 20 µg
View other "CABS1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208496 protein sequence
Red=Cloning site Green=Tags(s) MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYMLESDFSTTTDNKLTA KKEKLKSEDDMGTDFIKSTTHLQKEITSLTGTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIA KEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVPADEAVQVTDS IIPEAEIPPAPEESFTTIPDITALEEEKITEIDLSVLEDDTSAVATLTDSDEKFITVFELTTSAEKDKDK REDTLLTDEETTEGASIGMERDTANEAETHSVLLTAVESRYDFVVPASIATNLVEESSTEEDLSETDNTE TVPKITEPFSGTTSVLDTPDYKEDTSTTETDIFELLKEEPDEFMI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149113 |
Locus ID | 85438 |
UniProt ID | Q96KC9 |
Refseq Size | 1558 |
Cytogenetics | 4q13.3 |
Refseq ORF | 1185 |
Synonyms | C4orf35; CLPH; NYD-SP26 |
Summary | Calcium-binding protein (By similarity). Essential for maintaining the structural integrity of the sperm flagella (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A method to study protein biomarkers in saliva using an automated capillary nano-immunoassay platform (Wes™).
,null,
Journal of immunological methods
,PubMed ID 31972214
[CABS1]
|
Calcium-binding protein, spermatid-specific 1 is expressed in human salivary glands and contains an anti-inflammatory motif
,null,
American Journal of Physiology - Regulatory, Integrative and Comparative Physiology
,PubMed ID 25632019
[CABS1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409727 | CABS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409727 | Transient overexpression lysate of chromosome 4 open reading frame 35 (C4orf35) |
CNY 3,080.00 |
|
PH308496 | C4orf35 MS Standard C13 and N15-labeled recombinant protein (NP_149113) |
CNY 19,520.00 |