SURF5 (MED22) (NM_181491) Human Recombinant Protein
CAT#: TP308015
Recombinant protein of human mediator complex subunit 22 (MED22), transcript variant c, 20 µg
View other "SURF5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208015 protein sequence
Red=Cloning site Green=Tags(s) MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR AGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852468 |
Locus ID | 6837 |
UniProt ID | Q15528 |
Refseq Size | 3910 |
Cytogenetics | 9q34.2 |
Refseq ORF | 420 |
Synonyms | MED24; SRB6; surf-5; SURF5 |
Summary | This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405682 | MED22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405682 | Transient overexpression lysate of mediator complex subunit 22 (MED22), transcript variant c |
CNY 3,080.00 |
|
PH308015 | MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468) |
CNY 19,520.00 |