Pirh2 (RCHY1) (NM_015436) Human Recombinant Protein
CAT#: TP307970
Recombinant protein of human ring finger and CHY zinc finger domain containing 1 (RCHY1), transcript variant 1, 20 µg
View other "Pirh2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207970 protein sequence
Red=Cloning site Green=Tags(s) MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV SQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056251 |
Locus ID | 25898 |
UniProt ID | Q96PM5 |
Refseq Size | 4447 |
Cytogenetics | 4q21.1 |
Refseq ORF | 783 |
Synonyms | ARNIP; CHIMP; PIRH2; PRO1996; RNF199; ZCHY; ZNF363 |
Summary | The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | p53 signaling pathway, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402435 | RCHY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402435 | Transient overexpression lysate of ring finger and CHY zinc finger domain containing 1 (RCHY1), transcript variant 1 |
CNY 3,080.00 |
|
PH307970 | RCHY1 MS Standard C13 and N15-labeled recombinant protein (NP_056251) |
CNY 19,520.00 |