IGJ (JCHAIN) (NM_144646) Human Recombinant Protein
CAT#: TP307932
Recombinant protein of human immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207932 protein sequence
Red=Cloning site Green=Tags(s) MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY GGETKMVETALTPDACYPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653247 |
Locus ID | 3512 |
UniProt ID | P01591 |
Refseq Size | 1413 |
Cytogenetics | 4q13.3 |
Refseq ORF | 477 |
Synonyms | IGCJ; IGJ; JCH |
Summary | Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403400 | IGJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403400 | Transient overexpression lysate of immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ) |
CNY 3,080.00 |
|
PH307932 | IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247) |
CNY 19,520.00 |