SIGLECL1 (SIGLEC12) (NM_053003) Human Recombinant Protein
CAT#: TP307808
Recombinant protein of human sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 1, 20 µg
View other "SIGLECL1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207808 protein sequence
Red=Cloning site Green=Tags(s) MLLLLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHV SRNIPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYVFCVERGNMKWNYKYDQLSVN VTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNWTASSPVYGSWFKEGADIPWDIPVATNTPSG KVQEDTHGRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIP GTLESGHPRNLTCSVPWACEQGTPPTITWMGASVSSLDPTITRSSMLSLIPQPQDHGTSLTCQVTLPGAG VTMTRAVRLNISYPPQNLTMTVFQGDGTASTTLRNGSALSVLEGQSLHLVCAVDSNPPARLSWTWGSLTL SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPISGVTLGAFGGAGATAL VFLYFCIIFVVVRSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEE GEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443729 |
Locus ID | 89858 |
UniProt ID | Q96PQ1 |
Refseq Size | 2258 |
Cytogenetics | 19q13.41 |
Refseq ORF | 1785 |
Synonyms | S2V; Siglec-XII; SIGLECL1; SLG |
Summary | Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
AK002, a Humanized Sialic Acid-Binding Immunoglobulin-Like Lectin-8 Antibody that Induces Antibody-Dependent Cell-Mediated Cytotoxicity against Human Eosinophils and Inhibits Mast Cell-Mediated Anaphylaxis in Mice
,Youngblood, BA;Brock, EC;Leung, J;Falahati, R;Bryce, PJ;Bright, J;Williams, J;Shultz, LD;Greiner, DL;Brehm, MA;Bebbington, C;Tomasevic, N;,
Int. Arch. Allergy Immunol.
,PubMed ID 31401630
[SIGLEC12]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409355 | SIGLEC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409587 | SIGLEC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409355 | Transient overexpression lysate of sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 1 |
CNY 3,080.00 |
|
LY409587 | Transient overexpression lysate of sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 2 |
CNY 4,840.00 |
|
PH307808 | SIGLEC12 MS Standard C13 and N15-labeled recombinant protein (NP_443729) |
CNY 14,250.00 |
其它SIGLECL1产品