United States
Germany
Japan
United Kingdom
China
RNF41 (NM_194358) Human Recombinant Protein
CAT＃: TP307568
Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2, 20 µg
View other "RNF41" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207568 protein sequence
Red=Cloning site Green=Tags(s) MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_919339 |
| Locus ID | 10193 |
| UniProt ID | Q9H4P4 |
| Refseq Size | 5420 |
| Cytogenetics | 12q13.3 |
| Refseq ORF | 954 |
| Synonyms | FLRF; NRDP1; SBBI03 |
| Summary | This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405109 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405110 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417072 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405109 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 |
CNY 3,080.00 |
|
| LY405110 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 3 |
CNY 3,080.00 |
|
| LY417072 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 1 |
CNY 3,080.00 |
|
| PH307568 | RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339) |
CNY 19,520.00 |
|
| TP760790 | Purified recombinant protein of Human ring finger protein 41 (RNF41), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
