RASSF4 (NM_032023) Human Recombinant Protein
CAT#: TP307456
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 4 (RASSF4), 20 µg
View other "RASSF4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207456 protein sequence
Red=Cloning site Green=Tags(s) MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTK SDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNKF RVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPV LDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114412 |
Locus ID | 83937 |
UniProt ID | Q9H2L5 |
Refseq Size | 2509 |
Cytogenetics | 10q11.21 |
Refseq ORF | 963 |
Synonyms | AD037 |
Summary | The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403139 | RASSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403139 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 4 (RASSF4) |
CNY 3,080.00 |
|
PH307456 | RASSF4 MS Standard C13 and N15-labeled recombinant protein (NP_114412) |
CNY 19,520.00 |