CA5B (NM_007220) Human Recombinant Protein
CAT#: TP307002
Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein, 20 µg
View other "CA5B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207002 representing NM_007220
Red=Cloning site Green=Tags(s) MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009151 |
Locus ID | 11238 |
UniProt ID | Q9Y2D0 |
Refseq Size | 6032 |
Cytogenetics | Xp22.2 |
Refseq ORF | 951 |
Synonyms | CA-VB; CAVB |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. [provided by RefSeq, Jan 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416110 | CA5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416110 | Transient overexpression lysate of carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH307002 | CA5B MS Standard C13 and N15-labeled recombinant protein (NP_009151) |
CNY 19,520.00 |
|
TP720091 | Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein |
CNY 3,140.00 |