TAFA4 (NM_182522) Human Recombinant Protein
CAT#: TP306792
Recombinant protein of human family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1, 20 µg
View other "TAFA4" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206792 protein sequence
Red=Cloning site Green=Tags(s) MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEER SQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872328 |
Locus ID | 151647 |
UniProt ID | Q96LR4, A0A024R369 |
Refseq Size | 2294 |
Cytogenetics | 3p14.1 |
Refseq ORF | 420 |
Synonyms | FAM19A4; TAFA-4 |
Summary | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403635 | FAM19A4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423625 | FAM19A4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403635 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1 |
CNY 3,080.00 |
|
LY423625 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 2 |
CNY 3,080.00 |
|
PH306792 | FAM19A4 MS Standard C13 and N15-labeled recombinant protein (NP_872328) |
CNY 19,520.00 |
|
TP721173 | Purified recombinant protein of Human family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1 |
CNY 3,140.00 |