ERP27 (NM_152321) Human Recombinant Protein
CAT#: TP306683
Recombinant protein of human endoplasmic reticulum protein 27 (ERP27), 20 µg
View other "ERP27" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206683 protein sequence
Red=Cloning site Green=Tags(s) MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689534 |
Locus ID | 121506 |
UniProt ID | Q96DN0 |
Refseq Size | 1581 |
Cytogenetics | 12p12.3 |
Refseq ORF | 819 |
Synonyms | C12orf46; PDIA8 |
Summary | This gene encodes a noncatalytic member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. The canonical protein has an N-terminal signal sequence, two thioredoxin (TRX)-like domains and a C-terminal ER-retention sequence. Alternative splicing results in multiple transcript variants encoding distinct isoforms; some of which lack domains present in the canonical protein. [provided by RefSeq, Dec 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407647 | ERP27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407647 | Transient overexpression lysate of endoplasmic reticulum protein 27 (ERP27) |
CNY 3,080.00 |
|
PH306683 | ERP27 MS Standard C13 and N15-labeled recombinant protein (NP_689534) |
CNY 19,520.00 |