RABIF (NM_002871) Human Recombinant Protein
CAT#: TP306632
Recombinant protein of human RAB interacting factor (RABIF), 20 µg
View other "RABIF" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206632 protein sequence
Red=Cloning site Green=Tags(s) MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002862 |
Locus ID | 5877 |
UniProt ID | P47224, Q53EV1 |
Refseq Size | 3227 |
Cytogenetics | 1q32.1 |
Refseq ORF | 369 |
Synonyms | MSS4; RASGFR3; RASGRF3 |
Summary | This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419050 | RABIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419050 | Transient overexpression lysate of RAB interacting factor (RABIF) |
CNY 3,080.00 |
|
PH306632 | RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) |
CNY 19,520.00 |