Exodus 2 (CCL21) (NM_002989) Human Recombinant Protein
CAT#: TP306579
Recombinant protein of human chemokine (C-C motif) ligand 21 (CCL21), 20 µg
View other "Exodus 2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206579 protein sequence
Red=Cloning site Green=Tags(s) MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002980 |
Locus ID | 6366 |
UniProt ID | O00585 |
Refseq Size | 913 |
Cytogenetics | 9p13.3 |
Refseq ORF | 402 |
Synonyms | 6Ckine; CKb9; ECL; SCYA21; SLC; TCA4 |
Summary | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401047 | CCL21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401047 | Transient overexpression lysate of chemokine (C-C motif) ligand 21 (CCL21) |
CNY 3,080.00 |
|
PH306579 | CCL21 MS Standard C13 and N15-labeled recombinant protein (NP_002980) |
CNY 19,520.00 |
|
TP723794 | Purified recombinant protein of Human chemokine (C-C motif) ligand 21 (CCL21 / 6CKine) |
CNY 4,090.00 |
其它Exodus 2产品