CART (CARTPT) (NM_004291) Human Recombinant Protein
CAT#: TP306552
Recombinant protein of human CART prepropeptide (CARTPT), 20 µg
View other "CART" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206552 protein sequence
Red=Cloning site Green=Tags(s) MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004282 |
Locus ID | 9607 |
UniProt ID | Q16568 |
Refseq Size | 933 |
Cytogenetics | 5q13.2 |
Refseq ORF | 348 |
Synonyms | CART |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans. [provided by RefSeq, Feb 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418081 | CARTPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418081 | Transient overexpression lysate of CART prepropeptide (CARTPT) |
CNY 3,080.00 |
|
PH306552 | CARTPT MS Standard C13 and N15-labeled recombinant protein (NP_004282) |
CNY 19,520.00 |