TMEM25 (NM_032780) Human Recombinant Protein
CAT#: TP306385
Recombinant protein of human transmembrane protein 25 (TMEM25), transcript variant 1, 20 µg
View other "TMEM25" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206385 protein sequence
Red=Cloning site Green=Tags(s) MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL GYIYRVSSVSSDEIWL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116169 |
Locus ID | 84866 |
UniProt ID | Q86YD3 |
Refseq Size | 2551 |
Cytogenetics | 11q23.3 |
Refseq ORF | 1098 |
Summary | In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409928 | TMEM25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428484 | TMEM25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409928 | Transient overexpression lysate of transmembrane protein 25 (TMEM25), transcript variant 1 |
CNY 3,080.00 |
|
LY428484 | Transient overexpression lysate of transmembrane protein 25 (TMEM25), transcript variant 5 |
CNY 3,080.00 |
|
PH306385 | TMEM25 MS Standard C13 and N15-labeled recombinant protein (NP_116169) |
CNY 19,520.00 |