VPS36 (NM_016075) Human Recombinant Protein
CAT#: TP306006
Recombinant protein of human vacuolar protein sorting 36 homolog (S. cerevisiae) (VPS36), 20 µg
View other "VPS36" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206006 protein sequence
Red=Cloning site Green=Tags(s) MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057159 |
Locus ID | 51028 |
UniProt ID | Q86VN1 |
Refseq Size | 4473 |
Cytogenetics | 13q14.3 |
Refseq ORF | 1158 |
Synonyms | C13orf9; CGI-145; EAP45 |
Summary | This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II. [provided by RefSeq, Aug 2013] |
Protein Families | Transcription Factors |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414200 | VPS36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414200 | Transient overexpression lysate of vacuolar protein sorting 36 homolog (S. cerevisiae) (VPS36) |
CNY 3,080.00 |
|
PH306006 | VPS36 MS Standard C13 and N15-labeled recombinant protein (NP_057159) |
CNY 19,520.00 |