HDHD2 (NM_032124) Human Recombinant Protein
CAT#: TP305967
Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2), 20 µg
View other "HDHD2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205967 protein sequence
Red=Cloning site Green=Tags(s) MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISED EIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPL IAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDV GGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115500 |
Locus ID | 84064 |
UniProt ID | Q9H0R4 |
Refseq Size | 2245 |
Cytogenetics | 18q21.1 |
Refseq ORF | 777 |
Synonyms | 3110052N05Rik; HEL-S-301 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403144 | HDHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403144 | Transient overexpression lysate of haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) |
CNY 3,080.00 |
|
PH305967 | HDHD2 MS Standard C13 and N15-labeled recombinant protein (NP_115500) |
CNY 19,520.00 |
|
TP720246 | Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2) |
CNY 1,800.00 |