CEBP Beta (CEBPB) (NM_005194) Human Recombinant Protein
CAT#: TP305882
Recombinant protein of human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 20 µg
View other "CEBP Beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205882 representing NM_005194
Red=Cloning site Green=Tags(s) MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005185 |
Locus ID | 1051 |
UniProt ID | P17676 |
Refseq Size | 1837 |
Cytogenetics | 20q13.13 |
Refseq ORF | 1035 |
Synonyms | C/EBP-beta; IL6DBP; NF-IL6; TCF5 |
Summary | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Insulin induction of SREBP-1c in rodent liver requires LXRα-C/EBPβ complex
,null,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 27382175
[CEBPB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417451 | CEBPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417451 | Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) |
CNY 3,080.00 |
|
PH305882 | CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185) |
CNY 19,520.00 |
其它CEBP Beta产品