Calpain 2 (CAPN2) (NM_001748) Human Recombinant Protein
CAT#: TP305642
Recombinant protein of human calpain 2, (m/II) large subunit (CAPN2), 20 µg
View other "Calpain 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205642 protein sequence
Red=Cloning site Green=Tags(s) MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKT RGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFH FQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGG IAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQK LIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFE PNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRV LAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKA LEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 79.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001739 |
Locus ID | 824 |
UniProt ID | P17655 |
Refseq Size | 3492 |
Cytogenetics | 1q41 |
Refseq ORF | 2100 |
Synonyms | CANP2; CANPL2; CANPml; mCANP |
Summary | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Alzheimer's disease, Apoptosis, Focal adhesion |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Distinct Roles forµ-Calpain and m-Calpain in Synaptic NMDAR-Mediated Neuroprotection and Extrasynaptic NMDAR-Mediated Neurodegeneration
,Wang, Y;Briz, V;Chishti, A;Bi, X;Baudry, M;,
J. Neurosci. 18880-92
,PubMed ID 24285894
[CAPN2]
|
Calpain-2-Mediated PTEN Degradation Contributes to BDNF-Induced Stimulation of Dendritic Protein Synthesis
,Victor Briz, Yu-Tien Hsu, Yi Li, Erin Lee, Xiaoning Bi, and Michel Baudry,
J. Neurosci., Mar 2013; 33: 4317 - 4328.
[CAPN2]
|
Early to Intermediate Steps of Tumor Embolic Formation Involve Specific Proteolytic Processing of E-Cadherin Regulated by Rab7
,Yin Ye, Jian-Xin Gao, Honglin Tian, Kurtis Yearsley, Alicia R. Lange, Fredika M. Robertson, and Sanford H. Barsky,
Mol. Cancer Res., Jun 2012; 10: 713 - 726.
[CAPN2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400662 | CAPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400662 | Transient overexpression lysate of calpain 2, (m/II) large subunit (CAPN2), transcript variant 1 |
CNY 3,080.00 |
|
PH305642 | CAPN2 MS Standard C13 and N15-labeled recombinant protein (NP_001739) |
CNY 19,520.00 |
其它Calpain 2产品