VTA1 (NM_016485) Human Recombinant Protein
CAT#: TP305442
Recombinant protein of human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 20 µg
View other "VTA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205442 protein sequence
Red=Cloning site Green=Tags(s) MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG SALQYEDVSTAVQNLQKALKLLTTGRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057569 |
Locus ID | 51534 |
UniProt ID | Q9NP79 |
Refseq Size | 3371 |
Cytogenetics | 6q24.1-q24.2 |
Refseq ORF | 921 |
Synonyms | C6orf55; DRG-1; DRG1; HSPC228; LIP5; My012; SBP1 |
Summary | C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413927 | VTA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413927 | Transient overexpression lysate of Vps20-associated 1 homolog (S. cerevisiae) (VTA1) |
CNY 3,080.00 |
|
PH305442 | VTA1 MS Standard C13 and N15-labeled recombinant protein (NP_057569) |
CNY 19,520.00 |