Calponin (CNN1) (NM_001299) Human Recombinant Protein
CAT#: TP305370
Recombinant protein of human calponin 1, basic, smooth muscle (CNN1), 20 µg
View other "Calponin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 3,600.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205370 protein sequence
Red=Cloning site Green=Tags(s) MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE LGEPAHNHHAHNYYNSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001290 |
Locus ID | 1264 |
UniProt ID | P51911, V9HWA5 |
Refseq Size | 1599 |
Cytogenetics | 19p13.2 |
Refseq ORF | 891 |
Synonyms | HEL-S-14; Sm-Calp; SMCC |
Summary | Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400519 | CNN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400519 | Transient overexpression lysate of calponin 1, basic, smooth muscle (CNN1) |
CNY 3,080.00 |
|
PH305370 | CNN1 MS Standard C13 and N15-labeled recombinant protein (NP_001290) |
CNY 19,520.00 |
|
TP762396 | Purified recombinant protein of Human calponin 1, basic, smooth muscle (CNN1), Leu67-Gly257, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Calponin产品