RAB40B (NM_006822) Human Recombinant Protein
CAT#: TP305261
Recombinant protein of human RAB40B, member RAS oncogene family (RAB40B), 20 µg
View other "RAB40B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205261 protein sequence
Red=Cloning site Green=Tags(s) MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESTYGHPAGIDYKTTTILLDGRRVKLQLWDT SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQ AQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVD KLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006813 |
Locus ID | 10966 |
UniProt ID | Q12829 |
Refseq Size | 1776 |
Cytogenetics | 17q25.3 |
Refseq ORF | 834 |
Synonyms | RAR; SEC4L |
Summary | The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416399 | RAB40B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416399 | Transient overexpression lysate of RAB40B, member RAS oncogene family (RAB40B) |
CNY 3,080.00 |
|
PH305261 | RAB40B MS Standard C13 and N15-labeled recombinant protein (NP_006813) |
CNY 19,520.00 |