STK32A (NM_145001) Human Recombinant Protein
CAT#: TP304769
Recombinant protein of human serine/threonine kinase 32A (STK32A), transcript variant 2, 20 µg
View other "STK32A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204769 protein sequence
Red=Cloning site Green=Tags(s) MGANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFK ELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQ RIIHRDMKPDNILLDEHDTWLSYKSH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659438 |
Locus ID | 202374 |
UniProt ID | Q8WU08 |
Refseq Size | 888 |
Cytogenetics | 5q32 |
Refseq ORF | 498 |
Synonyms | YANK1 |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408139 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426375 | STK32A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408139 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 2 |
CNY 3,080.00 |
|
LY426375 | Transient overexpression lysate of serine/threonine kinase 32A (STK32A), transcript variant 1 |
CNY 3,080.00 |
|
PH304769 | STK32A MS Standard C13 and N15-labeled recombinant protein (NP_659438) |
CNY 19,520.00 |