DARC (ACKR1) (NM_002036) Human Recombinant Protein
CAT#: TP304680
Recombinant protein of human Duffy blood group, chemokine receptor (DARC), transcript variant 2, 20 µg
View other "DARC" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204680 protein sequence
Red=Cloning site Green=Tags(s) MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002027 |
Locus ID | 2532 |
UniProt ID | Q16570 |
Refseq Size | 2024 |
Cytogenetics | 1q23.2 |
Refseq ORF | 1008 |
Synonyms | CCBP1; CD234; DARC; DARC/ACKR1; Dfy; FY; GPD; GpFy; WBCQ1 |
Summary | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400744 | ACKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426584 | ACKR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400744 | Transient overexpression lysate of Duffy blood group, chemokine receptor (DARC), transcript variant 2 |
CNY 3,080.00 |
|
LY426584 | Transient overexpression lysate of Duffy blood group, chemokine receptor (DARC), transcript variant 1 |
CNY 3,080.00 |
|
PH304680 | DARC MS Standard C13 and N15-labeled recombinant protein (NP_002027) |
CNY 19,520.00 |