HLA (NM_182549) Human Recombinant Protein
CAT#: TP304511
Recombinant protein of human major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204511 representing NM_182549
Red=Cloning site Green=Tags(s) MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL NHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS LQSPITVEWRPRGPPPAGLLH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872355 |
Locus ID | 3120 |
UniProt ID | P05538 |
Refseq Size | 1092 |
Cytogenetics | 6p21.32 |
Refseq ORF | 693 |
Synonyms | HLA-DQB1; HLA-DXB |
Summary | HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. [provided by RefSeq, Oct 2010] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Soluble factors derived from human amniotic epithelial cells suppress collagen production in human hepatic stellate cells.
,null,
Cytotherapy
,PubMed ID 24642017
[HLA]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403637 | HLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403637 | Transient overexpression lysate of major histocompatibility complex, class II, DQ beta 2 (HLA-DQB2) |
CNY 3,080.00 |
|
PH304511 | HLA MS Standard C13 and N15-labeled recombinant protein (NP_872355) |
CNY 19,520.00 |