HNRPAB (HNRNPAB) (NM_031266) Human Recombinant Protein
CAT#: TP304360
Recombinant protein of human heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1, 20 µg
View other "HNRPAB" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204360 representing NM_031266
Red=Cloning site Green=Tags(s) MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG KMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVI DPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKK VLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGY GYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112556 |
Locus ID | 3182 |
UniProt ID | Q99729 |
Refseq Size | 1837 |
Cytogenetics | 5q35.3 |
Refseq ORF | 996 |
Synonyms | ABBP1; HNRPAB |
Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410605 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417947 | HNRNPAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410605 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 1 |
CNY 3,080.00 |
|
LY417947 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A/B (HNRNPAB), transcript variant 2 |
CNY 3,080.00 |
|
PH304360 | HNRNPAB MS Standard C13 and N15-labeled recombinant protein (NP_112556) |
CNY 19,520.00 |