TID1 (DNAJA3) (NM_005147) Human Recombinant Protein
CAT#: TP304240
Purified recombinant protein of Homo sapiens DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 1, 20 µg
View other "TID1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204240 protein sequence
Red=Cloning site Green=Tags(s) MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT GTKHYPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005138 |
Locus ID | 9093 |
UniProt ID | Q96EY1, Q53G26, Q59E88 |
Refseq Size | 2780 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1440 |
Synonyms | HCA57; hTID-1; TID1 |
Summary | This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized to mitochondria and mediates several cellular processes including proliferation, survival and apoptotic signal transduction. The encoded protein also plays a critical role in tumor suppression through interactions with oncogenic proteins including ErbB2 and the p53 tumor suppressor protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417489 | DNAJA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427556 | DNAJA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417489 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 1 |
CNY 3,080.00 |
|
LY427556 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 2 |
CNY 3,080.00 |
|
PH304240 | DNAJA3 MS Standard C13 and N15-labeled recombinant protein (NP_005138) |
CNY 14,250.00 |