BTN2A2 (NM_006995) Human Recombinant Protein
CAT#: TP304232
Purified recombinant protein of Homo sapiens butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1, 20 µg
View other "BTN2A2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204232 protein sequence
Red=Cloning site Green=Tags(s) MEPAAALHFSLPASLLLLLLLLLLSLCALVSAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRW FRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEA ILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTA VIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTASPWMVSMTVILAVFIIFMA VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVR RGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTL EMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDD SPIFICPALTGASGVMVPEEGLKLHRVGTHQSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008926 |
Locus ID | 10385 |
UniProt ID | Q8WVV5, A0A024R038 |
Refseq Size | 3602 |
Cytogenetics | 6p22.2 |
Refseq ORF | 1569 |
Synonyms | BT2.2; BTF2; BTN2.2 |
Summary | Butyrophilin is the major protein associated with fat droplets in the milk. This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is a type I receptor glycoprotein involved in lipid, fatty-acid and sterol metabolism. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405693 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416278 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434155 | BTN2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405693 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 2 |
CNY 3,080.00 |
|
LY416278 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 1 |
CNY 3,080.00 |
|
LY434155 | Transient overexpression lysate of butyrophilin, subfamily 2, member A2 (BTN2A2), transcript variant 5 |
CNY 3,080.00 |
|
PH304232 | BTN2A2 MS Standard C13 and N15-labeled recombinant protein (NP_008926) |
CNY 14,250.00 |