Ku70 (XRCC6) (NM_001469) Human Recombinant Protein
CAT#: TP304048
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 6 (XRCC6), 20 µg
View other "Ku70" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204048 protein sequence
Red=Cloning site Green=Tags(s) MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGG FDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNL EALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.7 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001460 |
Locus ID | 2547 |
UniProt ID | P12956 |
Refseq Size | 2284 |
Cytogenetics | 22q13.2 |
Refseq ORF | 1827 |
Synonyms | CTC75; CTCBF; G22P1; KU70; ML8; TLAA |
Summary | The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Non-homologous end-joining |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
CSL controls telomere maintenance and genome stability in human dermal fibroblasts
,Bottoni, G;Katarkar, A;Tassone, B;Ghosh, S;Clocchiatti, A;Goruppi, S;Bordignon, P;Jafari, P;Tordini, F;Lunardi, T;Hoetzenecker, W;Neel, V;Lingner, J;Paolo Dotto, G;,
Nat Commun
,PubMed ID 31467287
[XRCC6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400567 | XRCC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400567 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 6 (XRCC6) |
CNY 3,080.00 |
|
PH304048 | XRCC6 MS Standard C13 and N15-labeled recombinant protein (NP_001460) |
CNY 19,520.00 |