APOBEC3C (NM_014508) Human Recombinant Protein
CAT#: TP303971
Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), 20 µg
View other "APOBEC3C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203971 protein sequence
Red=Cloning site Green=Tags(s) MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055323 |
Locus ID | 27350 |
UniProt ID | Q9NRW3 |
Refseq Size | 1127 |
Cytogenetics | 22q13.1 |
Refseq ORF | 570 |
Synonyms | A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI |
Summary | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415212 | APOBEC3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415212 | Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) |
CNY 3,080.00 |
|
PH303971 | APOBEC3C MS Standard C13 and N15-labeled recombinant protein (NP_055323) |
CNY 19,520.00 |
其它APOBEC3C产品