Papillary renal cell carcinoma (PRCC) (NM_005973) Human Recombinant Protein
CAT#: TP303805
Recombinant protein of human papillary renal cell carcinoma (translocation-associated) (PRCC), transcript variant 1, 20 µg
View other "Papillary renal cell carcinoma" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203805 protein sequence
Red=Cloning site Green=Tags(s) MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPP PTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGLNLPPPIGGAGPPLGLPKPKK RKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSD GSPDTKPSRLASKTKTSSLAPVVGTTTTTPSPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLP EKAEPPGVEPYPYPIPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTY GDANAAGAYYQDYYSGGYYPAQDPALVPTQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG F myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005964 |
Locus ID | 5546 |
UniProt ID | Q92733, A0A0S2Z456, Q96FT4 |
Refseq Size | 2142 |
Cytogenetics | 1q23.1 |
Refseq ORF | 1473 |
Synonyms | RCCP1; TPRC |
Summary | This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X;1)(p11;q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein is expressed in affected carcinomas and is likely associated with altered gene transactivation. This fusion protein has also been associated with disruption of the cell cycle.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416956 | PRCC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416956 | Transient overexpression lysate of papillary renal cell carcinoma (translocation-associated) (PRCC), transcript variant 1 |
CNY 3,080.00 |
|
PH303805 | PRCC MS Standard C13 and N15-labeled recombinant protein (NP_005964) |
CNY 19,520.00 |
其它Papillary renal cell carcinoma产品