RXYLT1 (NM_014254) Human Recombinant Protein
CAT#: TP303762
Recombinant protein of human transmembrane protein 5 (TMEM5), 20 µg
View other "RXYLT1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203762 protein sequence
Red=Cloning site Green=Tags(s) MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH FKTELKMKFTNILESSFLMNNKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (PMID: 27130732) |
Reference Data | |
RefSeq | NP_055069 |
Locus ID | 10329 |
UniProt ID | Q9Y2B1 |
Refseq Size | 1963 |
Cytogenetics | 12q14.2 |
Refseq ORF | 1329 |
Synonyms | HP10481; MDDGA10; TMEM5 |
Summary | This gene encodes a type II transmembrane protein that is thought to have glycosyltransferase function. Mutations in this gene result in cobblestone lissencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The functional O-mannose glycan on a-dystroglycan contains a phospho-ribitol primed for matriglycan addition
,Praissman, JL;Willer, T;Sheikh, MO;Toi, A;Chitayat, D;Lin, YY;Lee, H;Stalnaker, SH;Wang, S;Prabhakar, PK;Nelson, SF;Stemple, DL;Moore, SA;Moremen, KW;Campbell, KP;Wells, L;,
Elife
,PubMed ID 27130732
[RXYLT1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415410 | TMEM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415410 | Transient overexpression lysate of transmembrane protein 5 (TMEM5) |
CNY 3,080.00 |
|
PH303762 | TMEM5 MS Standard C13 and N15-labeled recombinant protein (NP_055069) |
CNY 19,520.00 |